PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G223200.1.p
Common NamePRUPE_ppa016153mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WRKY
Protein Properties Length: 186aa    MW: 20977.6 Da    PI: 10.1045
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G223200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.65.2e-33106164159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ +v++tYeg H h+
  Prupe.1G223200.1.p 106 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGIVVTTYEGMHSHP 164
                         59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-3491164IPR003657WRKY domain
SuperFamilySSF1182907.72E-3098165IPR003657WRKY domain
PROSITE profilePS5081130.102101166IPR003657WRKY domain
SMARTSM007748.9E-39106165IPR003657WRKY domain
PfamPF031061.1E-26107164IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MENYQTFFSS AATPPASSSL SLNMGNPHGA YRTTDHLQFQ NNKSPPPANG FLGLMSDMEV  60
SNNINSSQSK SFGGPETAVR LGTKKGEKKI RKPRYAFQTR SQVDILDDGY RWRKYGQKAV  120
KNNKFPRSYY RCTHQGCNVK KQVQRLTKDE GIVVTTYEGM HSHPIEKSTD NFEHILSQMQ  180
IYTSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-2896165776Probable WRKY transcription factor 4
2lex_A6e-2896165776Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00506DAPTransfer from AT5G13080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF8879821e-107KF887982.1 Malus baccata WRKY75 (WRKY75) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007226197.11e-140hypothetical protein PRUPE_ppa016153mg
SwissprotQ9FYA21e-58WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLM5XPE91e-139M5XPE9_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s16750.11e-75(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.13e-59WRKY DNA-binding protein 75